Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) automatically mapped to Pfam PF00303 |
Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins) |
Protein automated matches [190469] (17 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [224938] (3 PDB entries) |
Domain d4foxh_: 4fox H: [221420] automated match to d1jg0a_ complexed with d16, ump |
PDB Entry: 4fox (more details), 2.3 Å
SCOPe Domain Sequences for d4foxh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4foxh_ d.117.1.1 (H:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} mtpyedllrfvletgtpksdrtgtgtrslfgqqmrydlsagfpllttkkvhfksvayell wflrgdsnigwlhehgvtiwdewasdtgelgpiygvqwrswpapsgehidqisaaldllr tdpdsrriivsawnvgeiermalppchaffqfyvadgrlscqlyqrsadlflgvpfnias yallthmmaaqaglsvgefiwtggdchiydnhveqvrlqlsreprpypkllladrdsife ytyedivvknydphpaika
Timeline for d4foxh_: