Lineage for d4foxe_ (4fox E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2972108Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2972109Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2972110Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2972567Protein automated matches [190469] (17 species)
    not a true protein
  7. 2972706Species Mycobacterium tuberculosis [TaxId:83332] [224938] (3 PDB entries)
  8. 2972713Domain d4foxe_: 4fox E: [221417]
    automated match to d1jg0a_
    complexed with d16, ump

Details for d4foxe_

PDB Entry: 4fox (more details), 2.3 Å

PDB Description: Crystal Structure of Mtb ThyA in complex with dUMP and Raltitrexed
PDB Compounds: (E:) Thymidylate synthase

SCOPe Domain Sequences for d4foxe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4foxe_ d.117.1.1 (E:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mtpyedllrfvletgtpksdrtgtgtrslfgqqmrydlsagfpllttkkvhfksvayell
wflrgdsnigwlhehgvtiwdewasdtgelgpiygvqwrswpapsgehidqisaaldllr
tdpdsrriivsawnvgeiermalppchaffqfyvadgrlscqlyqrsadlflgvpfnias
yallthmmaaqaglsvgefiwtggdchiydnhveqvrlqlsreprpypkllladrdsife
ytyedivvknydphpaikap

SCOPe Domain Coordinates for d4foxe_:

Click to download the PDB-style file with coordinates for d4foxe_.
(The format of our PDB-style files is described here.)

Timeline for d4foxe_: