SCOPe 2.08: Domain d3mlxl2: 3mlx L:109-209

Lineage for d3mlxl2 (3mlx L:109-209)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d3mlxl2: 3mlx L:109-209 [213357]
   Other proteins in same PDB: d3mlxh1, d3mlxh2, d3mlxi1, d3mlxi2, d3mlxl1, d3mlxm1
   automated match to d1q1jl2

Details for d3mlxl2

PDB Entry: 3mlx, 1.9 Å

PDB Description: crystal structure of anti-hiv-1 v3 fab 3074 in complex with an mn v3 peptide

PDB Compounds: (L:) Human monoclonal anti-HIV-1 gp120 V3 antibody 3074 Fab light chain

SCOPe Domain Sequences for d3mlxl2:

Sequence; same for both SEQRES and ATOM records:

>d3mlxl2 b.1.1.2 (L:109-209) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvragvetttpskqs
nnkyaassylsltpeqwkshrsyscqvthegstvektvapt

Timeline for d3mlxl2:

• d3mlxl2 first appeared in SCOPe 2.03
  
• d3mlxl2 appears in SCOPe 2.07