SCOP 1.65: Domain d1fj1b2: 1fj1 B:115-213

Lineage for d1fj1b2 (1fj1 B:115-213)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (237 PDB entries)

8. Domain d1fj1b2: 1fj1 B:115-213 [21149]
   Other proteins in same PDB: d1fj1a1, d1fj1a2, d1fj1b1, d1fj1c1, d1fj1c2, d1fj1d1, d1fj1e_, d1fj1f_

Details for d1fj1b2

PDB Entry: 1fj1, 2.68 Å

PDB Description: lyme disease antigen ospa in complex with neutralizing antibody fab la-2

SCOP Domain Sequences for d1fj1b2:

Sequence; same for both SEQRES and ATOM records:

>d1fj1b2 b.1.1.2 (B:115-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
kttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsgl
ytmsssvtvpsstwpsqtvtcsvahpassttvdkkleps

Timeline for d1fj1b2:

• d1fj1b2 first appeared (with stable ids) in SCOP 1.55
  
• d1fj1b2 appears in SCOP 1.63
  
• d1fj1b2 appears in SCOP 1.67
  
• d1fj1b2 appears in the current release, SCOPe 2.08