Class b: All beta proteins [48724] (126 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88576] (237 PDB entries) |
Domain d1fj1b2: 1fj1 B:115-213 [21149] Other proteins in same PDB: d1fj1a1, d1fj1a2, d1fj1b1, d1fj1c1, d1fj1c2, d1fj1d1, d1fj1e_, d1fj1f_ |
PDB Entry: 1fj1 (more details), 2.68 Å
SCOP Domain Sequences for d1fj1b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fj1b2 b.1.1.2 (B:115-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)} kttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsgl ytmsssvtvpsstwpsqtvtcsvahpassttvdkkleps
Timeline for d1fj1b2: