SCOP 1.65: Domain d1fj1a1: 1fj1 A:1-107

Lineage for d1fj1a1 (1fj1 A:1-107)

Root: SCOP 1.65
Class b: All beta proteins [48724] (126 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species

Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (146 PDB entries)
Domain d1fj1a1: 1fj1 A:1-107 [20118]
Other proteins in same PDB: d1fj1a2, d1fj1b1, d1fj1b2, d1fj1c2, d1fj1d1, d1fj1d2, d1fj1e_, d1fj1f_

Details for d1fj1a1

PDB Entry: 1fj1 (more details), 2.68 Å

PDB Description: lyme disease antigen ospa in complex with neutralizing antibody fab la-2

SCOP Domain Sequences for d1fj1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fj1a1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
diqmtqspsslsatlggkvtitckasqdinkyiawyqhkpgkgprllihytstlqpgnps
rfsgsgsgrdysfsisnleaediaiyyclqydnlqrtfgggtkveik

SCOP Domain Coordinates for d1fj1a1:

Click to download the PDB-style file with coordinates for d1fj1a1.
(The format of our PDB-style files is described here.)

Timeline for d1fj1a1: