Lineage for d1fj1b2 (1fj1 B:115-213)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221592Species Fab LA-2 (mouse), kappa L chain [49037] (1 PDB entry)
    against OspA
  8. 221594Domain d1fj1b2: 1fj1 B:115-213 [21149]
    Other proteins in same PDB: d1fj1a1, d1fj1b1, d1fj1c1, d1fj1d1, d1fj1e_, d1fj1f_

Details for d1fj1b2

PDB Entry: 1fj1 (more details), 2.68 Å

PDB Description: lyme disease antigen ospa in complex with neutralizing antibody fab la-2

SCOP Domain Sequences for d1fj1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fj1b2 b.1.1.2 (B:115-213) Immunoglobulin (constant domains of L and H chains) {Fab LA-2 (mouse), kappa L chain}
kttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsgl
ytmsssvtvpsstwpsqtvtcsvahpassttvdkkleps

SCOP Domain Coordinates for d1fj1b2:

Click to download the PDB-style file with coordinates for d1fj1b2.
(The format of our PDB-style files is described here.)

Timeline for d1fj1b2: