Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) |
Family d.142.1.0: automated matches [227184] (1 protein) not a true family |
Protein automated matches [226904] (39 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [225373] (3 PDB entries) |
Domain d2yznb2: 2yzn B:115-319 [207758] Other proteins in same PDB: d2yzna1, d2yznb1, d2yznc1 automated match to d1e4ea2 complexed with anp |
PDB Entry: 2yzn (more details), 2.6 Å
SCOPe Domain Sequences for d2yznb2:
Sequence, based on SEQRES records: (download)
>d2yznb2 d.142.1.0 (B:115-319) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} dkdlskrvlaqagvpvvpwvavrkgeppvvpfdppffvkpantgssvgisrverfqdlea alalafrydekavvekalspvrelevgvlgnvfgeaspvgevryeapfydyetkytpgra ellipapldpgtqetvqelalkaykvlgvrgmarvdfflaegelylnelntipgftptsm yprlfeaggvaypellrrlvelalt
>d2yznb2 d.142.1.0 (B:115-319) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} dkdlskrvlaqagvpvvpwvavrkgeppvvpfdppffvkpantgssvgisrverfqdlea alalafrydekavvekalspvrelevgvlgnvfgeaspvgevryeapfytpgraellipa pldpgtqetvqelalkaykvlgvrgmarvdfflaegelylnelntipgftptsmyprlfe aggvaypellrrlvelalt
Timeline for d2yznb2:
View in 3D Domains from other chains: (mouse over for more information) d2yzna1, d2yzna2, d2yznc1, d2yznc2 |