Lineage for d2yznc1 (2yzn C:1-114)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2861871Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2861872Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2862338Family c.30.1.0: automated matches [227183] (1 protein)
    not a true family
  6. 2862339Protein automated matches [226903] (40 species)
    not a true protein
  7. 2862489Species Thermus thermophilus HB8 [TaxId:300852] [225372] (3 PDB entries)
  8. 2862495Domain d2yznc1: 2yzn C:1-114 [207759]
    Other proteins in same PDB: d2yzna2, d2yznb2, d2yznc2
    automated match to d1e4ea1
    complexed with anp

Details for d2yznc1

PDB Entry: 2yzn (more details), 2.6 Å

PDB Description: Crystal structure of D-alanine:D-Alanine Ligase with AMPPNP from Thermus thermophilus HB8.
PDB Compounds: (C:) D-alanine-D-alanine ligase

SCOPe Domain Sequences for d2yznc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yznc1 c.30.1.0 (C:1-114) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mrvlliaggvspehevsllsaegvlrhipfptdlaviaqdgrwllgekaltaleakaape
gehpfppplswerydvvfpllhgrfgedgtvqgflellgkpyvgagvaasalcm

SCOPe Domain Coordinates for d2yznc1:

Click to download the PDB-style file with coordinates for d2yznc1.
(The format of our PDB-style files is described here.)

Timeline for d2yznc1: