PDB entry 2yzn

View 2yzn on RCSB PDB site
Description: Crystal structure of D-alanine:D-Alanine Ligase with AMPPNP from Thermus thermophilus HB8.
Class: ligase
Keywords: D-Alanine:D-Alanine Ligase, Cell shape, Peptidoglycan synthesis, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, LIGASE
Deposited on 2007-05-06, released 2007-11-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.23
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D-alanine-D-alanine ligase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2yzna1, d2yzna2
  • Chain 'B':
    Compound: D-alanine-D-alanine ligase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2yznb1, d2yznb2
  • Chain 'C':
    Compound: D-alanine-D-alanine ligase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2yznc1, d2yznc2
  • Heterogens: ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2yznA (A:)
    mrvlliaggvspehevsllsaegvlrhipfptdlaviaqdgrwllgekaltaleakaape
    gehpfppplswerydvvfpllhgrfgedgtvqgflellgkpyvgagvaasalcmdkdlsk
    rvlaqagvpvvpwvavrkgeppvvpfdppffvkpantgssvgisrverfqdleaalalaf
    rydekavvekalspvrelevgvlgnvfgeaspvgevryeapfydyetkytpgraellipa
    pldpgtqetvqelalkaykvlgvrgmarvdfflaegelylnelntipgftptsmyprlfe
    aggvaypellrrlvelalt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yznA (A:)
    mrvlliaggvspehevsllsaegvlrhipfptdlaviaqdgrwllgekaltaleakaape
    gehpfppplswerydvvfpllhgrfgedgtvqgflellgkpyvgagvaasalcmdkdlsk
    rvlaqagvpvvpwvavrkgeppvvpfdppffvkpantsvgisrverfqdleaalalafry
    dekavvekalspvrelevgvlgnvfgeaspvgevryeapfydyetkytpgraellipapl
    dpgtqetvqelalkaykvlgvrgmarvdfflaegelylnelntipgftptsmyprlfeag
    gvaypellrrlvelalt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2yznB (B:)
    mrvlliaggvspehevsllsaegvlrhipfptdlaviaqdgrwllgekaltaleakaape
    gehpfppplswerydvvfpllhgrfgedgtvqgflellgkpyvgagvaasalcmdkdlsk
    rvlaqagvpvvpwvavrkgeppvvpfdppffvkpantgssvgisrverfqdleaalalaf
    rydekavvekalspvrelevgvlgnvfgeaspvgevryeapfydyetkytpgraellipa
    pldpgtqetvqelalkaykvlgvrgmarvdfflaegelylnelntipgftptsmyprlfe
    aggvaypellrrlvelalt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yznB (B:)
    mrvlliaggvspehevsllsaegvlrhipfptdlaviaqdgrwllgekaltaleakaape
    gehpfppplswerydvvfpllhgrfgedgtvqgflellgkpyvgagvaasalcmdkdlsk
    rvlaqagvpvvpwvavrkgeppvvpfdppffvkpantgssvgisrverfqdleaalalaf
    rydekavvekalspvrelevgvlgnvfgeaspvgevryeapfytpgraellipapldpgt
    qetvqelalkaykvlgvrgmarvdfflaegelylnelntipgftptsmyprlfeaggvay
    pellrrlvelalt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2yznC (C:)
    mrvlliaggvspehevsllsaegvlrhipfptdlaviaqdgrwllgekaltaleakaape
    gehpfppplswerydvvfpllhgrfgedgtvqgflellgkpyvgagvaasalcmdkdlsk
    rvlaqagvpvvpwvavrkgeppvvpfdppffvkpantgssvgisrverfqdleaalalaf
    rydekavvekalspvrelevgvlgnvfgeaspvgevryeapfydyetkytpgraellipa
    pldpgtqetvqelalkaykvlgvrgmarvdfflaegelylnelntipgftptsmyprlfe
    aggvaypellrrlvelalt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yznC (C:)
    mrvlliaggvspehevsllsaegvlrhipfptdlaviaqdgrwllgekaltaleakaape
    gehpfppplswerydvvfpllhgrfgedgtvqgflellgkpyvgagvaasalcmdkdlsk
    rvlaqagvpvvpwvavrkgeppvvpfdppffvkpantgssvgisrverfqdleaalalaf
    rydekavvekalspvrelevgvlgnvfgeaspvgevryeapgraellipapldpgtqetv
    qelalkaykvlgvrgmarvdfflaegelylnelntipgftptsmyprlfeaggvaypell
    rrlvelalt