Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species) |
Species CAMPATH-1G igg2b monoclonal fab (rat), kappa L chain [48867] (1 PDB entry) |
Domain d1bfoa1: 1bfo A:1-107 [20310] Other proteins in same PDB: d1bfoa2, d1bfob2, d1bfoc2, d1bfod2, d1bfoe2, d1bfof2, d1bfog2, d1bfoh2 |
PDB Entry: 1bfo (more details), 2.6 Å
SCOP Domain Sequences for d1bfoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bfoa1 b.1.1.1 (A:1-107) Immunoglobulin (variable domains of L and H chains) {CAMPATH-1G igg2b monoclonal fab (rat), kappa L chain} dikmtqspsflsasvgdrvtlnckasqnidkylnwyqqklgespklliyntnnlqtgips rfsgsgsgtdftltisslqpedvatyfclqhisrprtfgtgtklelk
Timeline for d1bfoa1: