Lineage for d1bfoh1 (1bfo H:1-121)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 157740Species CAMPATH-1G igg2b monoclonal fab (rat), kappa L chain [48867] (1 PDB entry)
  8. 157748Domain d1bfoh1: 1bfo H:1-121 [20317]
    Other proteins in same PDB: d1bfoa2, d1bfob2, d1bfoc2, d1bfod2, d1bfoe2, d1bfof2, d1bfog2, d1bfoh2

Details for d1bfoh1

PDB Entry: 1bfo (more details), 2.6 Å

PDB Description: campath-1g igg2b rat monoclonal fab

SCOP Domain Sequences for d1bfoh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bfoh1 b.1.1.1 (H:1-121) Immunoglobulin (variable domains of L and H chains) {CAMPATH-1G igg2b monoclonal fab (rat), kappa L chain}
evkllesggglvqpggsmrlscagsgftftdfymnwirqpagkapewlgfirdkakgytt
eynpsvkgrftisrdntqnmlylqmntlraedtatyycareghtaapfdywgqgvmvtvs
s

SCOP Domain Coordinates for d1bfoh1:

Click to download the PDB-style file with coordinates for d1bfoh1.
(The format of our PDB-style files is described here.)

Timeline for d1bfoh1: