Lineage for d1bfob2 (1bfo B:122-216)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 159225Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)
  7. 159443Species CAMPATH-1G igg2b monoclonal fab (rat), kappa L chain [49077] (1 PDB entry)
  8. 159445Domain d1bfob2: 1bfo B:122-216 [21303]
    Other proteins in same PDB: d1bfoa1, d1bfob1, d1bfoc1, d1bfod1, d1bfoe1, d1bfof1, d1bfog1, d1bfoh1

Details for d1bfob2

PDB Entry: 1bfo (more details), 2.6 Å

PDB Description: campath-1g igg2b rat monoclonal fab

SCOP Domain Sequences for d1bfob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bfob2 b.1.1.2 (B:122-216) Immunoglobulin (constant domains of L and H chains) {CAMPATH-1G igg2b monoclonal fab (rat), kappa L chain}
aqttapsvyplapgcgdttsstvtlgclvkgyfpepvtvtwnsgalssdvhtfpavlqsg
lytltssvtsstwpsqtvtcnvahpasstkvdkkv

SCOP Domain Coordinates for d1bfob2:

Click to download the PDB-style file with coordinates for d1bfob2.
(The format of our PDB-style files is described here.)

Timeline for d1bfob2: