SCOP 1.59: Domain d1bfoa1: 1bfo A:1-107

Lineage for d1bfoa1 (1bfo A:1-107)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)

7. Species CAMPATH-1G igg2b monoclonal fab (rat), kappa L chain [48867] (1 PDB entry)

8. Domain d1bfoa1: 1bfo A:1-107 [20310]
   Other proteins in same PDB: d1bfoa2, d1bfob2, d1bfoc2, d1bfod2, d1bfoe2, d1bfof2, d1bfog2, d1bfoh2

Details for d1bfoa1

PDB Entry: 1bfo, 2.6 Å

PDB Description: campath-1g igg2b rat monoclonal fab

SCOP Domain Sequences for d1bfoa1:

Sequence; same for both SEQRES and ATOM records:

>d1bfoa1 b.1.1.1 (A:1-107) Immunoglobulin (variable domains of L and H chains) {CAMPATH-1G igg2b monoclonal fab (rat), kappa L chain}
dikmtqspsflsasvgdrvtlnckasqnidkylnwyqqklgespklliyntnnlqtgips
rfsgsgsgtdftltisslqpedvatyfclqhisrprtfgtgtklelk

Timeline for d1bfoa1:

• d1bfoa1 first appeared (with stable ids) in SCOP 1.55
  
• d1bfoa1 appears in SCOP 1.57
  
• d1bfoa1 appears in SCOP 1.61
  
• d1bfoa1 appears in the current release, SCOPe 2.08