Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d4en3b1: 4en3 B:2-117 [201880] Other proteins in same PDB: d4en3a2, d4en3a3, d4en3b2, d4en3c1, d4en3c2, d4en3d_ automated match to d1ktke1 complexed with agh, fuc, gol, nag |
PDB Entry: 4en3 (more details), 2.57 Å
SCOPe Domain Sequences for d4en3b1:
Sequence, based on SEQRES records: (download)
>d4en3b1 b.1.1.0 (B:2-117) automated matches {Human (Homo sapiens) [TaxId: 9606]} adiyqtprylvigtgkkitlecsqtmghdkmywyqqdpgmelhlihysygvnstekgdls sestvsrirtehfpltlesarpshtsqylcassensgtgriyeqyfgpgtrltvte
>d4en3b1 b.1.1.0 (B:2-117) automated matches {Human (Homo sapiens) [TaxId: 9606]} adiyqtprylvigtgkkitlecsqtmghdkmywyqqdpgmelhlihysygvnstekgdls estvsrirtehfpltlesarpshtsqylcassensgtgriyeqyfgpgtrltvte
Timeline for d4en3b1: