SCOPe 2.07: Domain d4en3b1: 4en3 B:2-117

Lineage for d4en3b1 (4en3 B:2-117)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d4en3b1: 4en3 B:2-117 [201880]
   Other proteins in same PDB: d4en3a2, d4en3a3, d4en3b2, d4en3c1, d4en3c2, d4en3d_
   automated match to d1ktke1
   complexed with agh, fuc, gol, nag

Details for d4en3b1

PDB Entry: 4en3, 2.57 Å

PDB Description: crystal structure of a human valpha24(-) nkt tcr in complex with cd1d/alpha-galactosylceramide

PDB Compounds: (B:) human nkt tcr beta chain

SCOPe Domain Sequences for d4en3b1:

Sequence, based on SEQRES records:

>d4en3b1 b.1.1.0 (B:2-117) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adiyqtprylvigtgkkitlecsqtmghdkmywyqqdpgmelhlihysygvnstekgdls
sestvsrirtehfpltlesarpshtsqylcassensgtgriyeqyfgpgtrltvte

Sequence, based on observed residues (ATOM records):

>d4en3b1 b.1.1.0 (B:2-117) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adiyqtprylvigtgkkitlecsqtmghdkmywyqqdpgmelhlihysygvnstekgdls
estvsrirtehfpltlesarpshtsqylcassensgtgriyeqyfgpgtrltvte

Timeline for d4en3b1:

• d4en3b1 first appeared in SCOPe 2.03
  
• d4en3b1 appears in SCOPe 2.06
  
• d4en3b1 appears in the current release, SCOPe 2.08