SCOPe 2.06: Domain d4d9rd2: 4d9r D:108-213

Lineage for d4d9rd2 (4d9r D:108-213)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)

8. Domain d4d9rd2: 4d9r D:108-213 [201651]
   Other proteins in same PDB: d4d9ra_, d4d9rb_, d4d9rd1, d4d9rl1
   automated match to d1rhha2
   complexed with cl

Details for d4d9rd2

PDB Entry: 4d9r, 2.42 Å

PDB Description: inhibiting alternative pathway complement activation by targeting the exosite on factor d

PDB Compounds: (D:) Fab light chain

SCOPe Domain Sequences for d4d9rd2:

Sequence; same for both SEQRES and ATOM records:

>d4d9rd2 b.1.1.2 (D:108-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d4d9rd2:

• d4d9rd2 first appeared in SCOPe 2.03
  
• d4d9rd2 appears in SCOPe 2.05
  
• d4d9rd2 appears in SCOPe 2.07
  
• d4d9rd2 appears in the current release, SCOPe 2.08