Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [88569] (151 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody |
Domain d4d9rd2: 4d9r D:108-213 [201651] Other proteins in same PDB: d4d9ra_, d4d9rb_, d4d9rd1, d4d9rl1 automated match to d1rhha2 complexed with cl |
PDB Entry: 4d9r (more details), 2.42 Å
SCOPe Domain Sequences for d4d9rd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4d9rd2 b.1.1.2 (D:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge
Timeline for d4d9rd2:
View in 3D Domains from other chains: (mouse over for more information) d4d9ra_, d4d9rb_, d4d9rl1, d4d9rl2 |