![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies) two antiparallel transmembrane helices |
![]() | Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) ![]() |
![]() | Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins) |
![]() | Protein Bacterial ba3 type cytochrome c oxidase subunit II [81460] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [81459] (23 PDB entries) the "missing" first helix is complemented by the ba3 subunit IIa |
![]() | Domain d3qjqb1: 3qjq B:3-40 [200354] Other proteins in same PDB: d3qjqa_, d3qjqb2, d3qjqc_ automated match to d1ehkb2 complexed with cmo, cu1, cua, has, hem fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 3qjq (more details), 2.9 Å
SCOPe Domain Sequences for d3qjqb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qjqb1 f.17.2.1 (B:3-40) Bacterial ba3 type cytochrome c oxidase subunit II {Thermus thermophilus [TaxId: 274]} dehkahkailayekgwlafslamlfvfialiaytlath
Timeline for d3qjqb1: