Lineage for d3qjqb1 (3qjq B:3-40)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1456154Fold f.17: Transmembrane helix hairpin [81334] (5 superfamilies)
    two antiparallel transmembrane helices
  4. 1456176Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) (S)
  5. 1456177Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)
  6. 1456194Protein Bacterial ba3 type cytochrome c oxidase subunit II [81460] (1 species)
  7. 1456195Species Thermus thermophilus [TaxId:274] [81459] (19 PDB entries)
    the "missing" first helix is complemented by the ba3 subunit IIa
  8. 1456210Domain d3qjqb1: 3qjq B:3-40 [200354]
    Other proteins in same PDB: d3qjqa_, d3qjqb2, d3qjqc_
    automated match to d1ehkb2
    complexed with cmo, cu1, cua, has, hem

Details for d3qjqb1

PDB Entry: 3qjq (more details), 2.9 Å

PDB Description: the structure of and photolytic induced changes of carbon monoxide binding to the cytochrome ba3-oxidase from thermus thermophilus
PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d3qjqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qjqb1 f.17.2.1 (B:3-40) Bacterial ba3 type cytochrome c oxidase subunit II {Thermus thermophilus [TaxId: 274]}
dehkahkailayekgwlafslamlfvfialiaytlath

SCOPe Domain Coordinates for d3qjqb1:

Click to download the PDB-style file with coordinates for d3qjqb1.
(The format of our PDB-style files is described here.)

Timeline for d3qjqb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3qjqb2