SCOPe 2.08: Domain d3qjqa_: 3qjq A:

Lineage for d3qjqa_ (3qjq A:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
   12 transmembrane helices in an approximate threefold rotational symmetric arrangement

4. Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family)

5. Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
   the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3

6. Protein Bacterial ba3 type cytochrome c oxidase subunit I [81438] (1 species)

7. Species Thermus thermophilus [TaxId:274] [81437] (29 PDB entries)

8. Domain d3qjqa_: 3qjq A: [184451]
   Other proteins in same PDB: d3qjqb1, d3qjqb2, d3qjqc_
   automated match to d1ehka_
   complexed with cmo, cu1, cua, has, hem

Details for d3qjqa_

PDB Entry: 3qjq, 2.9 Å

PDB Description: the structure of and photolytic induced changes of carbon monoxide binding to the cytochrome ba3-oxidase from thermus thermophilus

PDB Compounds: (A:) Cytochrome c oxidase subunit 1

SCOPe Domain Sequences for d3qjqa_:

Sequence; same for both SEQRES and ATOM records:

>d3qjqa_ f.24.1.1 (A:) Bacterial ba3 type cytochrome c oxidase subunit I {Thermus thermophilus [TaxId: 274]}
vyeaypekkatlyflvlgflalivgslfgpfqalnygnvdaypllkrllpfvqsyyqglt
lhgvlnaivftqlfaqaimvylparelnmrpnmglmwlswwmafiglvvaalpllaneat
vlytfypplkghwafylgasvfvlstwvsiyivldlwrrwkaanpgkvtplvtymavvfw
lmwflaslglvleavlfllpwsfglvegvdplvartlfwwtghpivyfwllpayaiiyti
lpkqaggklvsdpmarlafllflllstpvgfhhqfadpgidptwkmihsvltlfvavpsl
mtaftvaaslefagrlrggrglfgwiralpwdnpafvapvlgllgfipggaggivnasft
ldyvvhntawvpghfhlqvaslvtltamgslywllpnltgkpisdaqrrlglavvwlwfl
gmmimavglhwagllnvprrayiaqvpdayphaavpmvfnvlagivllvalllfiyglfs
vllsrerkpelaeaplpfaevisgpedrrlvlamdrigfwfavaailvvlaygptlvqlf
ghlnpvpgwrlw

Timeline for d3qjqa_:

• d3qjqa_ first appeared in SCOPe 2.01
  
• d3qjqa_ appears in SCOPe 2.07