SCOPe 2.08: Domain d3qfje2: 3qfj E:118-246

Lineage for d3qfje2 (3qfj E:118-246)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (15 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
Domain d3qfje2: 3qfj E:118-246 [200338]
Other proteins in same PDB: d3qfja1, d3qfja2, d3qfjb1, d3qfjb2, d3qfjd1, d3qfjd2, d3qfje1
automated match to d1ktke2
complexed with gol

Details for d3qfje2

PDB Entry: 3qfj (more details), 2.29 Å

PDB Description: The complex between TCR A6 and human Class I MHC HLA-A2 with the modified TAX (Y5F) peptide

PDB Compounds: (E:) A6 beta chain

SCOPe Domain Sequences for d3qfje2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qfje2 b.1.1.2 (E:118-246) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpq
plkeqpalndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

SCOPe Domain Coordinates for d3qfje2:

Click to download the PDB-style file with coordinates for d3qfje2.
(The format of our PDB-style files is described here.)

Timeline for d3qfje2: