![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein CD2, first domain [48740] (2 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [48742] (5 PDB entries) |
![]() | Domain d1cdca_: 1cdc A: [19746] misfolded V (N-terminal) domain dimer |
PDB Entry: 1cdc (more details), 2 Å
SCOPe Domain Sequences for d1cdca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cdca_ b.1.1.1 (A:) CD2, first domain {Norway rat (Rattus norvegicus) [TaxId: 10116]} gtvwgalghginlnipnfqmtddidevrwergstlvaefkrkmkpflksgafeilangdl kiknltrddsgtynvtvystngtrildkaldlrile
Timeline for d1cdca_: