Lineage for d1cdca_ (1cdc A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2352524Protein CD2, first domain [48740] (2 species)
  7. 2352531Species Norway rat (Rattus norvegicus) [TaxId:10116] [48742] (5 PDB entries)
  8. 2352534Domain d1cdca_: 1cdc A: [19746]
    misfolded V (N-terminal) domain dimer

Details for d1cdca_

PDB Entry: 1cdc (more details), 2 Å

PDB Description: cd2, n-terminal domain (1-99), truncated form
PDB Compounds: (A:) cd2

SCOPe Domain Sequences for d1cdca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cdca_ b.1.1.1 (A:) CD2, first domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gtvwgalghginlnipnfqmtddidevrwergstlvaefkrkmkpflksgafeilangdl
kiknltrddsgtynvtvystngtrildkaldlrile

SCOPe Domain Coordinates for d1cdca_:

Click to download the PDB-style file with coordinates for d1cdca_.
(The format of our PDB-style files is described here.)

Timeline for d1cdca_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1cdcb_