Class b: All beta proteins [48724] (180 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.0: automated matches [191454] (1 protein) not a true family |
Protein automated matches [190698] (25 species) not a true protein |
Species Longfin inshore squid (Loligo pealei) [TaxId:6621] [189844] (2 PDB entries) |
Domain d3pp6c_: 3pp6 C: [183921] automated match to d1yiva1 complexed with pam; mutant |
PDB Entry: 3pp6 (more details), 1.9 Å
SCOPe Domain Sequences for d3pp6c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pp6c_ b.60.1.0 (C:) automated matches {Longfin inshore squid (Loligo pealei) [TaxId: 6621]} aadlagkwilessenfddymkavgvgmvmrkmanaatptqeikidgdswsiktsttfktt disftigqefdettgdgrkikttckidgnamiqdqkgspdsilsrevkdgkmhmilkvnd vvctrifkrvd
Timeline for d3pp6c_: