Lineage for d3pp6c_ (3pp6 C:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 957981Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 957982Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 958632Family b.60.1.0: automated matches [191454] (1 protein)
    not a true family
  6. 958633Protein automated matches [190698] (4 species)
    not a true protein
  7. 958640Species Longfin inshore squid (Loligo pealei) [TaxId:6621] [189844] (2 PDB entries)
  8. 958644Domain d3pp6c_: 3pp6 C: [183921]
    automated match to d1yiva1
    complexed with pam; mutant

Details for d3pp6c_

PDB Entry: 3pp6 (more details), 1.9 Å

PDB Description: rep1-nxsq fatty acid transporter y128f mutant
PDB Compounds: (C:) Sodium-calcium exchanger

SCOPe Domain Sequences for d3pp6c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pp6c_ b.60.1.0 (C:) automated matches {Longfin inshore squid (Loligo pealei) [TaxId: 6621]}
aadlagkwilessenfddymkavgvgmvmrkmanaatptqeikidgdswsiktsttfktt
disftigqefdettgdgrkikttckidgnamiqdqkgspdsilsrevkdgkmhmilkvnd
vvctrifkrvd

SCOPe Domain Coordinates for d3pp6c_:

Click to download the PDB-style file with coordinates for d3pp6c_.
(The format of our PDB-style files is described here.)

Timeline for d3pp6c_: