Class b: All beta proteins [48724] (180 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins) ten-stranded meander beta-sheet folded upon itself relates to the common fold by opening the barrel and insertion of beta-hairpin |
Protein P2 myelin protein [50868] (2 species) |
Species Horse (Equus caballus) [TaxId:9796] [141466] (1 PDB entry) Uniprot P02690 1-131 |
Domain d1yiva1: 1yiv A:1-131 [123367] complexed with epe, lda |
PDB Entry: 1yiv (more details), 2.1 Å
SCOPe Domain Sequences for d1yiva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yiva1 b.60.1.2 (A:1-131) P2 myelin protein {Horse (Equus caballus) [TaxId: 9796]} snkflgtwklvssenfddymkalgvglatrklgnlakptviiskkgdvitirtesgfknt eisfklgqefdettadnrkakstvtlaagalnqvqkwngnettikrklvdgkmvveckma svvctriyekv
Timeline for d1yiva1: