Lineage for d1yiva1 (1yiv A:1-131)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804862Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2805228Protein P2 myelin protein [50868] (2 species)
  7. 2805233Species Horse (Equus caballus) [TaxId:9796] [141466] (1 PDB entry)
    Uniprot P02690 1-131
  8. 2805234Domain d1yiva1: 1yiv A:1-131 [123367]
    complexed with epe, lda

Details for d1yiva1

PDB Entry: 1yiv (more details), 2.1 Å

PDB Description: Structure of myelin P2 protein from Equine spinal cord
PDB Compounds: (A:) myelin p2 protein

SCOPe Domain Sequences for d1yiva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yiva1 b.60.1.2 (A:1-131) P2 myelin protein {Horse (Equus caballus) [TaxId: 9796]}
snkflgtwklvssenfddymkalgvglatrklgnlakptviiskkgdvitirtesgfknt
eisfklgqefdettadnrkakstvtlaagalnqvqkwngnettikrklvdgkmvveckma
svvctriyekv

SCOPe Domain Coordinates for d1yiva1:

Click to download the PDB-style file with coordinates for d1yiva1.
(The format of our PDB-style files is described here.)

Timeline for d1yiva1: