SCOPe 2.05: Domain d3mgwa_: 3mgw A:

Lineage for d3mgwa_ (3mgw A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.5: G-type lysozyme [53987] (2 proteins)

6. Protein automated matches [191098] (3 species)
   not a true protein

7. Species Atlantic salmon (Salmo salar) [TaxId:8030] [189321] (2 PDB entries)

8. Domain d3mgwa_: 3mgw A: [181209]
   automated match to d153la_
   complexed with co, so4

Details for d3mgwa_

PDB Entry: 3mgw, 1.75 Å

PDB Description: thermodynamics and structure of a salmon cold-active goose-type lysozyme

PDB Compounds: (A:) Lysozyme g

SCOPe Domain Sequences for d3mgwa_:

Sequence; same for both SEQRES and ATOM records:

>d3mgwa_ d.2.1.5 (A:) automated matches {Atlantic salmon (Salmo salar) [TaxId: 8030]}
hhditkvdtsgaseitarqdkltlqgvdashklaehdlvrmnkykelitrvgqkhgldpa
iiagiisresragsaldhgwgdhgkgfglmqvdkryhkivgawdsekhisqgteiliefi
rriqakfpvwpkehqlkggisaynagdknvrtyermdvgttggdysndvvarsqwfksqg
y

Timeline for d3mgwa_:

• d3mgwa_ first appeared in SCOPe 2.01
  
• d3mgwa_ appears in SCOPe 2.04
  
• d3mgwa_ is called d3mgwa1 in SCOPe 2.06
  
• d3mgwa_ appears in the current release, SCOPe 2.08, called d3mgwa1