Lineage for d3mgwa_ (3mgw A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1013435Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1013436Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1014726Family d.2.1.5: G-type lysozyme [53987] (2 proteins)
  6. 1014734Protein automated matches [191098] (2 species)
    not a true protein
  7. 1014744Species Atlantic salmon (Salmo salar) [TaxId:8030] [189321] (1 PDB entry)
  8. 1014745Domain d3mgwa_: 3mgw A: [181209]
    automated match to d153la_
    complexed with co, so4

Details for d3mgwa_

PDB Entry: 3mgw (more details), 1.75 Å

PDB Description: thermodynamics and structure of a salmon cold-active goose-type lysozyme
PDB Compounds: (A:) Lysozyme g

SCOPe Domain Sequences for d3mgwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mgwa_ d.2.1.5 (A:) automated matches {Atlantic salmon (Salmo salar) [TaxId: 8030]}
hhditkvdtsgaseitarqdkltlqgvdashklaehdlvrmnkykelitrvgqkhgldpa
iiagiisresragsaldhgwgdhgkgfglmqvdkryhkivgawdsekhisqgteiliefi
rriqakfpvwpkehqlkggisaynagdknvrtyermdvgttggdysndvvarsqwfksqg
y

SCOPe Domain Coordinates for d3mgwa_:

Click to download the PDB-style file with coordinates for d3mgwa_.
(The format of our PDB-style files is described here.)

Timeline for d3mgwa_: