![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
![]() | Superfamily d.2.1: Lysozyme-like [53955] (12 families) ![]() |
![]() | Family d.2.1.5: G-type lysozyme [53987] (2 proteins) |
![]() | Protein automated matches [191098] (3 species) not a true protein |
![]() | Species Atlantic salmon (Salmo salar) [TaxId:8030] [189321] (2 PDB entries) |
![]() | Domain d3mgwa1: 3mgw A:7-185 [181209] Other proteins in same PDB: d3mgwa2 automated match to d153la_ complexed with co, so4 |
PDB Entry: 3mgw (more details), 1.75 Å
SCOPe Domain Sequences for d3mgwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mgwa1 d.2.1.5 (A:7-185) automated matches {Atlantic salmon (Salmo salar) [TaxId: 8030]} ditkvdtsgaseitarqdkltlqgvdashklaehdlvrmnkykelitrvgqkhgldpaii agiisresragsaldhgwgdhgkgfglmqvdkryhkivgawdsekhisqgteiliefirr iqakfpvwpkehqlkggisaynagdknvrtyermdvgttggdysndvvarsqwfksqgy
Timeline for d3mgwa1: