Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (16 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [186842] (99 PDB entries) |
Domain d3mc0a_: 3mc0 A: [180999] Other proteins in same PDB: d3mc0b1, d3mc0b2, d3mc0d1, d3mc0d2 automated match to d2aq3a1 complexed with act |
PDB Entry: 3mc0 (more details), 2 Å
SCOPe Domain Sequences for d3mc0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mc0a_ b.1.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} aavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygagstekgdip dgykasrpsqeqfslilesatpsqtsvyfcasggggtlyfgagtrlsvl
Timeline for d3mc0a_: