Lineage for d3mc0b2 (3mc0 B:116-233)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1402144Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1403556Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 1403767Family d.15.6.0: automated matches [227139] (1 protein)
    not a true family
  6. 1403768Protein automated matches [226841] (4 species)
    not a true protein
  7. 1403769Species Staphylococcus aureus [TaxId:1280] [225055] (5 PDB entries)
  8. 1403772Domain d3mc0b2: 3mc0 B:116-233 [199824]
    Other proteins in same PDB: d3mc0a_, d3mc0b1, d3mc0c_, d3mc0d1
    automated match to d1d5zc2
    complexed with act

Details for d3mc0b2

PDB Entry: 3mc0 (more details), 2 Å

PDB Description: Crystal Structure of Staphylococcal Enterotoxin G (SEG) in Complex with a Mouse T-cell Receptor beta Chain
PDB Compounds: (B:) Enterotoxin SEG

SCOPe Domain Sequences for d3mc0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mc0b2 d.15.6.0 (B:116-233) automated matches {Staphylococcus aureus [TaxId: 1280]}
nssenerdklitvqvtidnrqslgftittnknmvtiqeldykarhwltkekklyefdgsa
fesgyikfteknntsfwfdlfpkkelvpfvpykflniygdnkvvdsksikmevflnth

SCOPe Domain Coordinates for d3mc0b2:

Click to download the PDB-style file with coordinates for d3mc0b2.
(The format of our PDB-style files is described here.)

Timeline for d3mc0b2: