Lineage for d2aq3a1 (2aq3 A:2-117)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1289755Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 1289902Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (29 PDB entries)
  8. 1289923Domain d2aq3a1: 2aq3 A:2-117 [144825]
    Other proteins in same PDB: d2aq3b1, d2aq3b2, d2aq3c_, d2aq3d1, d2aq3d2, d2aq3e_, d2aq3f1, d2aq3f2, d2aq3g_, d2aq3h1, d2aq3h2

Details for d2aq3a1

PDB Entry: 2aq3 (more details), 2.3 Å

PDB Description: Crystal structure of T-cell receptor V beta domain variant complexed with superantigen SEC3
PDB Compounds: (A:) T-cell receptor beta chain V

SCOPe Domain Sequences for d2aq3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aq3a1 b.1.1.1 (A:2-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
aavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygagstekgdip
dgykasrpsqeqfslilesatpsqtsvyfcasggggtlyfgagtrlsvl

SCOPe Domain Coordinates for d2aq3a1:

Click to download the PDB-style file with coordinates for d2aq3a1.
(The format of our PDB-style files is described here.)

Timeline for d2aq3a1: