Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) |
Family d.15.6.0: automated matches [227139] (1 protein) not a true family |
Protein automated matches [226841] (4 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [225055] (5 PDB entries) |
Domain d3mc0d2: 3mc0 D:116-233 [199826] Other proteins in same PDB: d3mc0a_, d3mc0b1, d3mc0c_, d3mc0d1 automated match to d1d5zc2 complexed with act |
PDB Entry: 3mc0 (more details), 2 Å
SCOPe Domain Sequences for d3mc0d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mc0d2 d.15.6.0 (D:116-233) automated matches {Staphylococcus aureus [TaxId: 1280]} nssenerdklitvqvtidnrqslgftittnknmvtiqeldykarhwltkekklyefdgsa fesgyikfteknntsfwfdlfpkkelvpfvpykflniygdnkvvdsksikmevflnth
Timeline for d3mc0d2:
View in 3D Domains from other chains: (mouse over for more information) d3mc0a_, d3mc0b1, d3mc0b2, d3mc0c_ |