Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (9 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein SUMO-1 (smt3 homologue) [54241] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [54242] (8 PDB entries) Uniprot Q93068 |
Domain d3kydd_: 3kyd D: [179807] automated match to d1a5ra_ complexed with edo, vmx, zn |
PDB Entry: 3kyd (more details), 2.61 Å
SCOPe Domain Sequences for d3kydd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kydd_ d.15.1.1 (D:) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} eyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpke lgmeeedvievyqeqcg
Timeline for d3kydd_: