Lineage for d1a5ra_ (1a5r A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1892545Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1892546Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1892742Protein SUMO-1 (smt3 homologue) [54241] (3 species)
  7. 1892750Species Human (Homo sapiens) [TaxId:9606] [54242] (8 PDB entries)
    Uniprot Q93068
  8. 1892758Domain d1a5ra_: 1a5r A: [37597]

Details for d1a5ra_

PDB Entry: 1a5r (more details)

PDB Description: structure determination of the small ubiquitin-related modifier sumo- 1, nmr, 10 structures
PDB Compounds: (A:) sumo-1

SCOPe Domain Sequences for d1a5ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a5ra_ d.15.1.1 (A:) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]}
gsmsdqeakpstedlgdkkegeyiklkvigqdsseihfkvkmtthlkklkesycqrqgvp
mnslrflfegqriadnhtpkelgmeeedvievyqeqtgghstv

SCOPe Domain Coordinates for d1a5ra_:

Click to download the PDB-style file with coordinates for d1a5ra_.
(The format of our PDB-style files is described here.)

Timeline for d1a5ra_: