Lineage for d1b47a1 (1b47 A:178-263)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 280804Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 280805Superfamily a.39.1: EF-hand [47473] (10 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 281218Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (4 proteins)
  6. 281222Protein Cbl [47561] (1 species)
  7. 281223Species Human (Homo sapiens) [TaxId:9606] [47562] (3 PDB entries)
  8. 281225Domain d1b47a1: 1b47 A:178-263 [17381]
    Other proteins in same PDB: d1b47a2, d1b47a3, d1b47b2, d1b47b3, d1b47c2, d1b47c3

Details for d1b47a1

PDB Entry: 1b47 (more details), 2.2 Å

PDB Description: structure of the n-terminal domain of cbl in complex with its binding site in zap-70

SCOP Domain Sequences for d1b47a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b47a1 a.39.1.7 (A:178-263) Cbl {Human (Homo sapiens)}
tfritkadaaefwrkafgektivpwksfrqalhevhpissgleamalkstidltcndyis
vfefdiftrlfqpwssllrnwnslav

SCOP Domain Coordinates for d1b47a1:

Click to download the PDB-style file with coordinates for d1b47a1.
(The format of our PDB-style files is described here.)

Timeline for d1b47a1: