Class a: All alpha proteins [46456] (179 folds) |
Fold a.48: N-cbl like [47667] (3 superfamilies) 4 helices; bundle, left-handed twist; left-handed superhelix |
Superfamily a.48.1: N-terminal domain of cbl (N-cbl) [47668] (1 family) |
Family a.48.1.1: N-terminal domain of cbl (N-cbl) [47669] (1 protein) |
Protein N-terminal domain of cbl (N-cbl) [47670] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [47671] (3 PDB entries) |
Domain d1b47b2: 1b47 B:47-177 [17776] Other proteins in same PDB: d1b47a1, d1b47a3, d1b47b1, d1b47b3, d1b47c1, d1b47c3 |
PDB Entry: 1b47 (more details), 2.2 Å
SCOP Domain Sequences for d1b47b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b47b2 a.48.1.1 (B:47-177) N-terminal domain of cbl (N-cbl) {Human (Homo sapiens)} ppgtvdkkmvekcwklmdkvvrlcqnpklalknsppyildllpdtyqhlrtilsryegkm etlgeneyfrvfmenlmkktkqtislfkegkermyeensqprrnltklslifshmlaelk gifpsglfqgd
Timeline for d1b47b2: