Lineage for d1b47c3 (1b47 C:264-350)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 332255Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 332256Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 332257Family d.93.1.1: SH2 domain [55551] (25 proteins)
  6. 332319Protein Cbl [55587] (1 species)
  7. 332320Species Human (Homo sapiens) [TaxId:9606] [55588] (3 PDB entries)
  8. 332324Domain d1b47c3: 1b47 C:264-350 [40531]
    Other proteins in same PDB: d1b47a1, d1b47a2, d1b47b1, d1b47b2, d1b47c1, d1b47c2
    complexed with ca

Details for d1b47c3

PDB Entry: 1b47 (more details), 2.2 Å

PDB Description: structure of the n-terminal domain of cbl in complex with its binding site in zap-70

SCOP Domain Sequences for d1b47c3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b47c3 d.93.1.1 (C:264-350) Cbl {Human (Homo sapiens)}
thpgymafltydevkarlqkfihkpgsyifrlsctrlgqwaigyvtadgnilqtiphnkp
lfqalidgfregfylfpdgrnqnpdlt

SCOP Domain Coordinates for d1b47c3:

Click to download the PDB-style file with coordinates for d1b47c3.
(The format of our PDB-style files is described here.)

Timeline for d1b47c3: