Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices |
Superfamily d.93.1: SH2 domain [55550] (1 family) |
Family d.93.1.1: SH2 domain [55551] (25 proteins) |
Protein Cbl [55587] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [55588] (3 PDB entries) |
Domain d1b47b3: 1b47 B:264-350 [40530] Other proteins in same PDB: d1b47a1, d1b47a2, d1b47b1, d1b47b2, d1b47c1, d1b47c2 |
PDB Entry: 1b47 (more details), 2.2 Å
SCOP Domain Sequences for d1b47b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b47b3 d.93.1.1 (B:264-350) Cbl {Human (Homo sapiens)} thpgymafltydevkarlqkfihkpgsyifrlsctrlgqwaigyvtadgnilqtiphnkp lfqalidgfregfylfpdgrnqnpdlt
Timeline for d1b47b3: