Lineage for d2ausb_ (2aus B:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2262912Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2263926Superfamily g.41.16: Nop10-like SnoRNP [144210] (1 family) (S)
    automatically mapped to Pfam PF04135
  5. 2263927Family g.41.16.1: Nucleolar RNA-binding protein Nop10-like [144211] (3 proteins)
    Pfam PF04135; contains N-terminal zinc-finger domain similar to the insert finger of the Initiation factor eIF2 gamma subunit (75204)
  6. 2263949Protein automated matches [190486] (2 species)
    not a true protein
  7. 2263950Species Pyrococcus abyssi [TaxId:29292] [187428] (1 PDB entry)
  8. 2263951Domain d2ausb_: 2aus B: [162908]
    Other proteins in same PDB: d2ausa1, d2ausa2, d2ausc1, d2ausc2
    automated match to d2hvyc1
    complexed with po4, zn

Details for d2ausb_

PDB Entry: 2aus (more details), 2.1 Å

PDB Description: crystal structure of the archaeal box h/aca srnp nop10-cbf5 complex
PDB Compounds: (B:) Ribosome biogenesis protein Nop10

SCOPe Domain Sequences for d2ausb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ausb_ g.41.16.1 (B:) automated matches {Pyrococcus abyssi [TaxId: 29292]}
rirkcpkcgrytlketcpvcgektkvahpprfspedpygeyrrrlkrellgig

SCOPe Domain Coordinates for d2ausb_:

Click to download the PDB-style file with coordinates for d2ausb_.
(The format of our PDB-style files is described here.)

Timeline for d2ausb_: