Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.265: Pseudouridine synthase [100877] (1 superfamily) consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold |
Superfamily d.265.1: Pseudouridine synthase [55120] (5 families) the active site is the most conserved structural region of the superfamily and is located between the subdomains |
Family d.265.1.0: automated matches [227299] (1 protein) not a true family |
Protein automated matches [227125] (2 species) not a true protein |
Species Pyrococcus abyssi [TaxId:29292] [226787] (1 PDB entry) |
Domain d2ausa1: 2aus A:12-248 [197765] Other proteins in same PDB: d2ausa2, d2ausb_, d2ausc2, d2ausd_ automated match to d2apoa2 complexed with po4, zn |
PDB Entry: 2aus (more details), 2.1 Å
SCOPe Domain Sequences for d2ausa1:
Sequence, based on SEQRES records: (download)
>d2ausa1 d.265.1.0 (A:12-248) automated matches {Pyrococcus abyssi [TaxId: 29292]} adikrevivkddkaetnpkwgfppdkrpielhiqygvinldkppgptshevvawikriln lekaghggtldpkvsgvlpvaleratrvvqallpagkeyvalmhlhgdvpedkiravmke fegeiiqrpplrsavkrrlrtrkvyyieileidgrdvlfrvgveagtyirslihhiglal gvgahmaelrrtrsgpfkedetlvtlhdlvdyyhfwkedgieeyirkaiqpmekave
>d2ausa1 d.265.1.0 (A:12-248) automated matches {Pyrococcus abyssi [TaxId: 29292]} adikrevivkddkaetnpkwgfppdkrpielhiqygvinldkppgptshevvawikriln lekaghggtldpkvsgvlpvaleratrvvqallpagkeyvalmhlhgdvpedkiravmke fegeiiqrkvyyieileidgrdvlfrvgveagtyirslihhiglalgvgahmaelrrtrs gpfkedetlvtlhdlvdyyhfwkedgieeyirkaiqpmekave
Timeline for d2ausa1:
View in 3D Domains from other chains: (mouse over for more information) d2ausb_, d2ausc1, d2ausc2, d2ausd_ |