SCOPe 2.06: Domain d2ausa1: 2aus A:12-248

Lineage for d2ausa1 (2aus A:12-248)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
   consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold

4. Superfamily d.265.1: Pseudouridine synthase [55120] (5 families)
   the active site is the most conserved structural region of the superfamily and is located between the subdomains

5. Family d.265.1.0: automated matches [227299] (1 protein)
   not a true family

6. Protein automated matches [227125] (2 species)
   not a true protein

7. Species Pyrococcus abyssi [TaxId:29292] [226787] (1 PDB entry)

8. Domain d2ausa1: 2aus A:12-248 [197765]
   Other proteins in same PDB: d2ausa2, d2ausb_, d2ausc2, d2ausd_
   automated match to d2apoa2
   complexed with po4, zn

Details for d2ausa1

PDB Entry: 2aus, 2.1 Å

PDB Description: crystal structure of the archaeal box h/aca srnp nop10-cbf5 complex

PDB Compounds: (A:) pseudouridine synthase

SCOPe Domain Sequences for d2ausa1:

Sequence, based on SEQRES records:

>d2ausa1 d.265.1.0 (A:12-248) automated matches {Pyrococcus abyssi [TaxId: 29292]}
adikrevivkddkaetnpkwgfppdkrpielhiqygvinldkppgptshevvawikriln
lekaghggtldpkvsgvlpvaleratrvvqallpagkeyvalmhlhgdvpedkiravmke
fegeiiqrpplrsavkrrlrtrkvyyieileidgrdvlfrvgveagtyirslihhiglal
gvgahmaelrrtrsgpfkedetlvtlhdlvdyyhfwkedgieeyirkaiqpmekave

Sequence, based on observed residues (ATOM records):

>d2ausa1 d.265.1.0 (A:12-248) automated matches {Pyrococcus abyssi [TaxId: 29292]}
adikrevivkddkaetnpkwgfppdkrpielhiqygvinldkppgptshevvawikriln
lekaghggtldpkvsgvlpvaleratrvvqallpagkeyvalmhlhgdvpedkiravmke
fegeiiqrkvyyieileidgrdvlfrvgveagtyirslihhiglalgvgahmaelrrtrs
gpfkedetlvtlhdlvdyyhfwkedgieeyirkaiqpmekave

Timeline for d2ausa1:

• d2ausa1 first appeared in SCOPe 2.03
  
• d2ausa1 appears in SCOPe 2.05
  
• d2ausa1 appears in SCOPe 2.07
  
• d2ausa1 appears in the current release, SCOPe 2.08