SCOPe 2.06: Domain d2ausa2: 2aus A:249-334

Lineage for d2ausa2 (2aus A:249-334)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (14 families)

5. Family b.122.1.0: automated matches [191599] (1 protein)
   not a true family

6. Protein automated matches [191089] (7 species)
   not a true protein

7. Species Pyrococcus abyssi [TaxId:29292] [225092] (1 PDB entry)

8. Domain d2ausa2: 2aus A:249-334 [197766]
   Other proteins in same PDB: d2ausa1, d2ausb_, d2ausc1, d2ausd_
   automated match to d2apoa1
   complexed with po4, zn

Details for d2ausa2

PDB Entry: 2aus, 2.1 Å

PDB Description: crystal structure of the archaeal box h/aca srnp nop10-cbf5 complex

PDB Compounds: (A:) pseudouridine synthase

SCOPe Domain Sequences for d2ausa2:

Sequence; same for both SEQRES and ATOM records:

>d2ausa2 b.122.1.0 (A:249-334) automated matches {Pyrococcus abyssi [TaxId: 29292]}
hlpkiwikdsavaavahganltvpgivklnagikkgdlvaimtlkdelvalgkammstqe
mierskgiavdvekvfmprdwypklw

Timeline for d2ausa2:

• d2ausa2 first appeared in SCOPe 2.03
  
• d2ausa2 appears in SCOPe 2.05
  
• d2ausa2 appears in SCOPe 2.07
  
• d2ausa2 appears in the current release, SCOPe 2.08