SCOPe 2.01: Domain d2ausb_: 2aus B:

Lineage for d2ausb_ (2aus B:)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.16: Nop10-like SnoRNP [144210] (1 family)

5. Family g.41.16.1: Nucleolar RNA-binding protein Nop10-like [144211] (3 proteins)
   Pfam PF04135; contains N-terminal zinc-finger domain similar to the insert finger of the Initiation factor eIF2 gamma subunit (75204)

6. Protein automated matches [190486] (2 species)
   not a true protein

7. Species Pyrococcus abyssi [TaxId:29292] [187428] (1 PDB entry)

8. Domain d2ausb_: 2aus B: [162908]
   automated match to d2hvyc1
   complexed with po4, zn

Details for d2ausb_

PDB Entry: 2aus, 2.1 Å

PDB Description: crystal structure of the archaeal box h/aca srnp nop10-cbf5 complex

PDB Compounds: (B:) Ribosome biogenesis protein Nop10

SCOPe Domain Sequences for d2ausb_:

Sequence; same for both SEQRES and ATOM records:

>d2ausb_ g.41.16.1 (B:) automated matches {Pyrococcus abyssi [TaxId: 29292]}
rirkcpkcgrytlketcpvcgektkvahpprfspedpygeyrrrlkrellgig

Timeline for d2ausb_:

• d2ausb_ is new in SCOPe 2.01-stable
  
• d2ausb_ appears in SCOPe 2.02
  
• d2ausb_ appears in the current release, SCOPe 2.08