Lineage for d2z4kp1 (2z4k P:1-82)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1900537Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)
    beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234
  4. 1900538Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) (S)
  5. 1900539Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)
  6. 1900540Protein Ribosomal protein S16 [54567] (3 species)
  7. 1900543Species Escherichia coli [TaxId:562] [160143] (26 PDB entries)
    Uniprot P0A7T3 1-82
  8. 1900566Domain d2z4kp1: 2z4k P:1-82 [154066]
    Other proteins in same PDB: d2z4kb1, d2z4kc1, d2z4kc2, d2z4kd1, d2z4ke1, d2z4ke2, d2z4kf1, d2z4kg1, d2z4kh1, d2z4ki1, d2z4kj1, d2z4kk1, d2z4kl1, d2z4km1, d2z4kn1, d2z4kq1, d2z4kr1, d2z4ks1, d2z4kt1, d2z4ku1
    protein/RNA complex; complexed with mg, par
    protein/RNA complex; complexed with mg, par

Details for d2z4kp1

PDB Entry: 2z4k (more details), 4.45 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with paromomycin and ribosome recycling factor (RRF). This file contains the 30S subunit of the first 70S ribosome, with paromomycin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (P:) 30S ribosomal protein S16

SCOPe Domain Sequences for d2z4kp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z4kp1 d.27.1.1 (P:1-82) Ribosomal protein S16 {Escherichia coli [TaxId: 562]}
mvtirlarhgakkrpfyqvvvadsrnarngrfiervgffnpiasekeegtrldldriahw
vgqgatisdrvaalikevnkaa

SCOPe Domain Coordinates for d2z4kp1:

Click to download the PDB-style file with coordinates for d2z4kp1.
(The format of our PDB-style files is described here.)

Timeline for d2z4kp1: