Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) |
Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein) |
Protein Ribosomal protein S6 [54997] (4 species) |
Species Escherichia coli [TaxId:562] [160317] (24 PDB entries) Uniprot P02358 1-100 |
Domain d2z4kf1: 2z4k F:1-100 [154057] Other proteins in same PDB: d2z4kb1, d2z4kc1, d2z4kc2, d2z4kd1, d2z4ke1, d2z4ke2, d2z4kg1, d2z4kh1, d2z4ki1, d2z4kj1, d2z4kk1, d2z4kl1, d2z4km1, d2z4kn1, d2z4kp1, d2z4kq1, d2z4kr1, d2z4ks1, d2z4kt1, d2z4ku1 protein/RNA complex; complexed with mg, par protein/RNA complex; complexed with mg, par |
PDB Entry: 2z4k (more details), 4.45 Å
SCOPe Domain Sequences for d2z4kf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z4kf1 d.58.14.1 (F:1-100) Ribosomal protein S6 {Escherichia coli [TaxId: 562]} mrhyeivfmvhpdqseqvpgmierytaaitgaegkihrledwgrrqlaypinklhkahyv lmnveapqevidelettfrfndavirsmvmrtkhavteas
Timeline for d2z4kf1: