SCOPe 2.05: Domain d2z4ke2: 2z4k E:9-77

Lineage for d2z4ke2 (2z4k E:9-77)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.50: dsRBD-like [54767] (5 superfamilies)
   alpha-beta(3)-alpha; 2 layers: alpha/beta

4. Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families)

5. Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein)
   automatically mapped to Pfam PF00333

6. Protein Ribosomal S5 protein, N-terminal domain [54779] (3 species)
   lacks the N-terminal helix

7. Species Escherichia coli [TaxId:562] [160202] (24 PDB entries)
   Uniprot P0A7W1 9-77

8. Domain d2z4ke2: 2z4k E:9-77 [154056]
   Other proteins in same PDB: d2z4kb1, d2z4kc1, d2z4kc2, d2z4kd1, d2z4ke1, d2z4kf1, d2z4kg1, d2z4kh1, d2z4ki1, d2z4kj1, d2z4kk1, d2z4kl1, d2z4km1, d2z4kn1, d2z4kp1, d2z4kq1, d2z4kr1, d2z4ks1, d2z4kt1, d2z4ku1
   protein/RNA complex; complexed with mg, par
   protein/RNA complex; complexed with mg, par

Details for d2z4ke2

PDB Entry: 2z4k, 4.45 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with paromomycin and ribosome recycling factor (RRF). This file contains the 30S subunit of the first 70S ribosome, with paromomycin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.

PDB Compounds: (E:) 30S ribosomal protein S5

SCOPe Domain Sequences for d2z4ke2:

Sequence; same for both SEQRES and ATOM records:

>d2z4ke2 d.50.1.2 (E:9-77) Ribosomal S5 protein, N-terminal domain {Escherichia coli [TaxId: 562]}
elqekliavnrvsktvkggrifsftaltvvgdgngrvgfgygkarevpaaiqkamekarr
nminvalnn

Timeline for d2z4ke2:

• d2z4ke2 first appeared in SCOP 1.75
  
• d2z4ke2 appears in SCOPe 2.04
  
• d2z4ke2 appears in SCOPe 2.06
  
• d2z4ke2 appears in the current release, SCOPe 2.08