Lineage for d2z4ks1 (2z4k S:2-80)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1900608Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)
    alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123
  4. 1900609Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) (S)
    automatically mapped to Pfam PF00203
  5. 1900610Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)
  6. 1900611Protein Ribosomal protein S19 [54572] (2 species)
  7. 1900612Species Escherichia coli [TaxId:562] [160144] (26 PDB entries)
    Uniprot P0A7U3 2-80
  8. 1900635Domain d2z4ks1: 2z4k S:2-80 [154069]
    Other proteins in same PDB: d2z4kb1, d2z4kc1, d2z4kc2, d2z4kd1, d2z4ke1, d2z4ke2, d2z4kf1, d2z4kg1, d2z4kh1, d2z4ki1, d2z4kj1, d2z4kk1, d2z4kl1, d2z4km1, d2z4kn1, d2z4kp1, d2z4kq1, d2z4kr1, d2z4kt1, d2z4ku1
    protein/RNA complex; complexed with mg, par
    protein/RNA complex; complexed with mg, par

Details for d2z4ks1

PDB Entry: 2z4k (more details), 4.45 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with paromomycin and ribosome recycling factor (RRF). This file contains the 30S subunit of the first 70S ribosome, with paromomycin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (S:) 30S ribosomal protein S19

SCOPe Domain Sequences for d2z4ks1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z4ks1 d.28.1.1 (S:2-80) Ribosomal protein S19 {Escherichia coli [TaxId: 562]}
rslkkgpfidlhllkkvekavesgdkkplrtwsrrstifpnmigltiavhngrqhvpvfv
tdemvghklgefaptrtyr

SCOPe Domain Coordinates for d2z4ks1:

Click to download the PDB-style file with coordinates for d2z4ks1.
(The format of our PDB-style files is described here.)

Timeline for d2z4ks1: