![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
![]() | Protein Coagulation factor VIIa [50550] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50551] (90 PDB entries) Uniprot P08709 213-466 ! Uniprot P08709 213-446 |
![]() | Domain d2firh_: 2fir H: [133531] Other proteins in same PDB: d2firl1, d2firl2, d2firl3, d2firt1, d2firt2 automated match to d1cvwh_ complexed with 0g7, ca, cl, fuc, glc, mg, na, zn |
PDB Entry: 2fir (more details), 2 Å
SCOPe Domain Sequences for d2firh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2firh_ b.47.1.2 (H:) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} ivggkvcpkgecpwqvlllvngaqlcggtlintiwvvsaahcfdkiknwrnliavlgehd lsehdgdeqsrrvaqviipstyvpgttnhdiallrlhqpvvltdhvvplclpertfsert lafvrfslvsgwgqlldrgatalelmvlnvprlmtqdclqqsrkvgdspniteymfcagy sdgskdsckgdsggphathyrgtwyltgivswgqgcatvghfgvytrvsqyiewlqklmr seprpgvllrapfp
Timeline for d2firh_: