Class b: All beta proteins [48724] (165 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins) |
Protein Coagulation factor VIIa [50550] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [50551] (33 PDB entries) |
Domain d2firh1: 2fir H:16-257 [133531] Other proteins in same PDB: d2firl1, d2firl2, d2firl3, d2firt1, d2firt2 automatically matched to d1cvwh_ complexed with ca, cl, fuc, glc, mg, na, zn |
PDB Entry: 2fir (more details), 2 Å
SCOP Domain Sequences for d2firh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2firh1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} ivggkvcpkgecpwqvlllvngaqlcggtlintiwvvsaahcfdkiknwrnliavlgehd lsehdgdeqsrrvaqviipstyvpgttnhdiallrlhqpvvltdhvvplclpertfsert lafvrfslvsgwgqlldrgatalelmvlnvprlmtqdclqqsrkvgdspniteymfcagy sdgskdsckgdsggphathyrgtwyltgivswgqgcatvghfgvytrvsqyiewlqklmr seprpgvllrapfp
Timeline for d2firh1: