Class a: All alpha proteins [46456] (284 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (4 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H4 [47125] (5 species) |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (33 PDB entries) |
Domain d2f8nf1: 2f8n F:224-302 [133137] Other proteins in same PDB: d2f8na_, d2f8nd_, d2f8ne_, d2f8ng_, d2f8nh1, d2f8nk1 automatically matched to d1p3ob_ protein/DNA complex |
PDB Entry: 2f8n (more details), 2.9 Å
SCOPe Domain Sequences for d2f8nf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f8nf1 a.22.1.1 (F:224-302) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]} dniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvta mdvvyalkrqgrtlygfgg
Timeline for d2f8nf1: